RetrogeneDB ID: | retro_pabe_1364 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 16:59800891..59801230(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CCDC25 | ||
| Ensembl ID: | ENSPPYG00000018468 | ||
| Aliases: | None | ||
| Description: | Coiled-coil domain-containing protein 25 [Source:UniProtKB/Swiss-Prot;Acc:Q5R9S1] |
| Percent Identity: | 85.96 % |
| Parental protein coverage: | 54.81 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | NEDLIKHGWPEDIWFHVDKLSSAHVYLRLHKGENIEDIPKEVLMDCAHLVKANSIQGCKMNNVNVVYTPW |
| .EDLIKH.WPEDIWF..D.LSSAHVYL.LHK..NIEDIPKEVL.DC.HLVKANSIQGCK.NNVNVV.TPW | |
| Retrocopy | HEDLIKHSWPEDIWFRADRLSSAHVYLQLHKEKNIEDIPKEVLTDCTHLVKANSIQGCK-NNVNVVNTPW |
| Parental | SNLKKTADMDVGQIGFHRQKDVKIVTVEKKVNEILNRLEKTKVE |
| S.LKKTAD.DV.QIGFHRQKDVKIVT.EKKVNEILNRLEKTKVE | |
| Retrocopy | SDLKKTADVDVSQIGFHRQKDVKIVTMEKKVNEILNRLEKTKVE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 24 .16 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 14 .35 RPM |
| SRP007412_heart | 0 .00 RPM | 7 .59 RPM |
| SRP007412_kidney | 0 .00 RPM | 15 .58 RPM |
| SRP007412_liver | 0 .03 RPM | 9 .00 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1701 |
| Gorilla gorilla | retro_ggor_1274 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000012971 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000006595 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000006478 | 1 retrocopy | |
| Homo sapiens | ENSG00000147419 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000009685 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000015976 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000018468 | 2 retrocopies |
retro_pabe_1364 , retro_pabe_477,
|
| Pan troglodytes | ENSPTRG00000020109 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000018434 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000000732 | 1 retrocopy |