RetrogeneDB ID: | retro_pabe_1063 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 13:90775650..90776085(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | GRPEL2 | ||
| Ensembl ID: | ENSPPYG00000015933 | ||
| Aliases: | None | ||
| Description: | grpE protein homolog 2, mitochondrial precursor [Source:RefSeq peptide;Acc:NP_001127040] |
| Percent Identity: | 77.18 % |
| Parental protein coverage: | 66.22 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MAVRSLWACRLRVQRLLAWSAAWESKGWPLPFSTATQRTAGEDCRSEDPPDELGPPLAERALRVKAVKLE |
| .AV..LW......Q.LLA.SA.WE.KGW.L.FSTA.QRT.GED..SEDPPDELG..LAE.ALRVKAVKLE | |
| Retrocopy | LAVQLLW----QMQPLLASSAEWEGKGWLLLFSTAIQRTTGEDSSSEDPPDELGCSLAEWALRVKAVKLE |
| Parental | KEVQDLTVRYQRAVADCENIRRRTQRCVEDAKIFGIQSFCKDLVEVADILEKTTECISEESEPEDQKLTL |
| KEVQDL..RYQ.AVADCENIRR.TQRCVED.KIFGIQSFCK.LVEV..ILEKTTECISEE.EP.DQKLTL | |
| Retrocopy | KEVQDLMMRYQKAVADCENIRRGTQRCVEDSKIFGIQSFCKILVEVFHILEKTTECISEE*EPVDQKLTL |
| Parental | EKVFRGLLL |
| EKVF.GL.L | |
| Retrocopy | EKVFQGLSL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 10 .23 RPM |
| SRP007412_cerebellum | 0 .12 RPM | 15 .81 RPM |
| SRP007412_heart | 0 .06 RPM | 8 .61 RPM |
| SRP007412_kidney | 0 .00 RPM | 6 .46 RPM |
| SRP007412_liver | 0 .00 RPM | 5 .78 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1284 |
| Pan troglodytes | retro_ptro_877 |
| Macaca mulatta | retro_mmul_1317 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000004070 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000011142 | 1 retrocopy | |
| Felis catus | ENSFCAG00000003624 | 1 retrocopy | |
| Homo sapiens | ENSG00000164284 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000005410 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000021662 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000010160 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000016138 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000014326 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000014573 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000015933 | 2 retrocopies |
retro_pabe_1063 , retro_pabe_3764,
|
| Pan troglodytes | ENSPTRG00000017396 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000005467 | 2 retrocopies |