RetrogeneDB ID: | retro_mmul_1317 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 17:69486319..69486741(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | GRPEL2 | ||
| Ensembl ID: | ENSMMUG00000021662 | ||
| Aliases: | None | ||
| Description: | grpE protein homolog 2, mitochondrial [Source:RefSeq peptide;Acc:NP_001248082] |
| Percent Identity: | 73.97 % |
| Parental protein coverage: | 64.44 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MAVRSLWAGRLRVQRLLASTAAWDSKGWPLPFSTATQRTAGEDCRSEDPPDELGPSLTERALRVKAIKLE |
| .AV.SLW....R.Q.LLAS.A.W..KG..LPFSTA..RTAGEDC.SE.PP.ELG.SL.E.ALRVKA.KLE | |
| Retrocopy | LAVQSLW----RMQPLLASSAQWEGKG*LLPFSTAIRRTAGEDCSSEHPPAELGCSLAEWALRVKAVKLE |
| Parental | KEVQDLTLRYQRAVADCENIRRRTQRCV-EDAKIFGIQSFCKDLVEVADILEKTTECISEESEPENQKLT |
| KEVQDL..RYQRAVADCEN..RRTQRCV....KIFGIQSFCK.LVEV..ILEKTTECISEESEP..QK.T | |
| Retrocopy | KEVQDLMMRYQRAVADCENVTRRTQRCV<VNSKIFGIQSFCKILVEVLHILEKTTECISEESEPVDQKVT |
| Parental | LEKVFR |
| LEKVF. | |
| Retrocopy | LEKVFQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 1 .46 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 3 .49 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 1 .87 RPM |
| SRP007412_heart | 0 .06 RPM | 1 .83 RPM |
| SRP007412_kidney | 0 .00 RPM | 1 .53 RPM |
| SRP007412_liver | 0 .00 RPM | 1 .23 RPM |
| SRP007412_testis | 0 .00 RPM | 5 .09 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1284 |
| Pan troglodytes | retro_ptro_877 |
| Pongo abelii | retro_pabe_1063 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000004070 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000011142 | 1 retrocopy | |
| Felis catus | ENSFCAG00000003624 | 1 retrocopy | |
| Homo sapiens | ENSG00000164284 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000005410 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000021662 | 1 retrocopy |
retro_mmul_1317 ,
|
| Nomascus leucogenys | ENSNLEG00000010160 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000016138 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000014326 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000015933 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000017396 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000005467 | 2 retrocopies |