RetrogeneDB ID: | retro_ogar_1737 | ||
Retrocopy location | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873563.1:667774..668190(-) | ||
| Located in intron of: | ENSOGAG00000027104 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | AP3S2 | ||
| Ensembl ID: | ENSOGAG00000030982 | ||
| Aliases: | None | ||
| Description: | adaptor-related protein complex 3, sigma 2 subunit [Source:HGNC Symbol;Acc:571] |
| Percent Identity: | 65.73 % |
| Parental protein coverage: | 71.5 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 4 |
| Parental | ILVFNNHGKPRLVRFYQRFPEEI-QQQ-IVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIYRHYATLY |
| ..VF.N.GK.RLV.FYQ..PEEI.QQ...VRETFHLVLK.DDNICNF.....LI.GSDYKLIY.HY.TL. | |
| Retrocopy | LMVFSNCGKLRLVHFYQKLPEEIQQQM>VVRETFHLVLKQDDNICNFFKSKRLISGSDYKLIY*HYTTLS |
| Parental | FVFCVDSSESELGILDLIQV-FVETLDKCFENVCELDLIFHMDKV-HYILQEVVMGGMVLETNMN-EIVA |
| .VFCVD.SE..LG.LDLIQV.FVE.LDKCFEN.CEL....HMD.........V..G.MVLETNMN.EI.A | |
| Retrocopy | CVFCVDLSENKLGTLDLIQV>FVEILDKCFENMCELGFVVHMDDT<YVL*EVVICG-MVLETNMN>EIIA |
| Parental | QIE |
| .IE | |
| Retrocopy | EIE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000001407 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000003359 | 4 retrocopies | |
| Dipodomys ordii | ENSDORG00000004247 | 1 retrocopy | |
| Equus caballus | ENSECAG00000024044 | 1 retrocopy | |
| Felis catus | ENSFCAG00000028122 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000003421 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000019522 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011780 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000030982 | 1 retrocopy |
retro_ogar_1737 ,
|
| Otolemur garnettii | ENSOGAG00000032376 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000043141 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000030174 | 7 retrocopies | |
| Tursiops truncatus | ENSTTRG00000015554 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000008668 | 1 retrocopy |