RetrogeneDB ID: | retro_ocun_362 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 1:51762722..51763056(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CSNK2B | ||
| Ensembl ID: | ENSOCUG00000023483 | ||
| Aliases: | CSNK2B, CK-II, CK2N, Phosvitin | ||
| Description: | casein kinase 2, beta polypeptide (CSNK2B), mRNA [Source:RefSeq mRNA;Acc:NM_001160283] |
| Percent Identity: | 56.9 % |
| Parental protein coverage: | 53.02 % |
| Number of stop codons detected: | 6 |
| Number of frameshifts detected: | 2 |
| Parental | SEEVSWISWFCGLRGNEFFCEV-DEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLI |
| SEE.S.IS.F.GL..NE.FC...D..YIQDK.NLT.LNE.VP...Q..D.IL..EPDE...DNPNQS.LI | |
| Retrocopy | SEEMSQISRF*GLHRNELFCKM<DQEYIQDKCNLTRLNEHVPP**QVPDRILNPEPDEQQKDNPNQSNLI |
| Parental | EQAAEMLYGLIHARYILT-NRGIAQMLEKYQQGDFGYCPRVYCENQ |
| E...E..YGL......L....GI.QM.E..Q..DFG.CP.VYCENQ | |
| Retrocopy | EK-DESFYGLADTLSLLS<HLGITQMSE*WQR-DFG*CP*VYCENQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 91 .23 RPM |
| SRP017611_kidney | 0 .00 RPM | 96 .39 RPM |
| SRP017611_liver | 0 .00 RPM | 37 .07 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000005751 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000008837 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000002996 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000018728 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000014179 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000006417 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000015168 | 3 retrocopies | |
| Felis catus | ENSFCAG00000007642 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000004095 | 10 retrocopies | |
| Monodelphis domestica | ENSMODG00000015287 | 4 retrocopies | |
| Mustela putorius furo | ENSMPUG00000011129 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000023483 | 2 retrocopies |
retro_ocun_1477, retro_ocun_362 ,
|
| Ochotona princeps | ENSOPRG00000012138 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000001478 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000001414 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000014103 | 2 retrocopies |