RetrogeneDB ID: | retro_mmus_2709 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 5:147325954..147326334(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Mgst3 | ||
| Ensembl ID: | ENSMUSG00000026688 | ||
| Aliases: | None | ||
| Description: | microsomal glutathione S-transferase 3 [Source:MGI Symbol;Acc:MGI:1913697] |
| Percent Identity: | 81.82 % |
| Parental protein coverage: | 84.97 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | MAVLSKEYGFVLLTGAASFVMVLHLAINVGKARKKYKVEYPVMYSTDPENGHMFNCIQRAHQNTLEVYPP |
| MAVLSKEYGFVLLTGAASF.MVLHLAINVGKA.KK.KVEYPV.YSTDPE.GHMF.CIQR.HQN.LEV.PP | |
| Retrocopy | MAVLSKEYGFVLLTGAASFDMVLHLAINVGKACKKNKVEYPVTYSTDPESGHMFSCIQRVHQNVLEVHPP |
| Parental | FLFFLTVGGVYHPRIASGLGLAWI-IGRVLYAYGYYTGDPSKRYRGAV-GSLALFALMGTTV |
| .LFFLTVGGVY.PRIASGLGLA.I..GRVLY.YG....DPSKRYRGA..GSLALF.LMGT.. | |
| Retrocopy | SLFFLTVGGVYYPRIASGLGLALI>LGRVLYTYG----DPSKRYRGAT>GSLALFTLMGTAM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 39 .09 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 30 .18 RPM |
| SRP007412_heart | 0 .00 RPM | 88 .85 RPM |
| SRP007412_kidney | 0 .00 RPM | 49 .86 RPM |
| SRP007412_liver | 0 .00 RPM | 5 .41 RPM |
| SRP007412_testis | 0 .00 RPM | 2 .61 RPM |
| TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
|---|---|---|---|---|---|---|
| no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
| TSS #1 | TSS_112064 | 214 libraries | 178 libraries | 363 libraries | 134 libraries | 183 libraries |

| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006658 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000013353 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000012723 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000003507 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000003817 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000026688 | 1 retrocopy |
retro_mmus_2709 ,
|
| Oryctolagus cuniculus | ENSOCUG00000010376 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000015774 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000004245 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000005299 | 2 retrocopies |