RetrogeneDB ID: | retro_mmul_623 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 10:30325578..30325887(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMMUG00000018462 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ARPC5L | ||
| Ensembl ID: | ENSMMUG00000020628 | ||
| Aliases: | None | ||
| Description: | Actin-related protein 2/3 complex subunit 5 [Source:UniProtKB/TrEMBL;Acc:F7BM58] |
| Percent Identity: | 68.93 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | GDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPT |
| G....A..AAL.N.P.NTK.QAVK.RA...VLKVL..FK...IE..VQS.D.NGVDLLMK.IYKGFE.P. | |
| Retrocopy | GNVTAALQAALKNLPINTKSQAVKDRAGSIVLKVLISFKANDIEKTVQSPDKNGVDLLMKCIYKGFESPS |
| Parental | ENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV |
| .NSSAVLLQW.EKALA.GG.GSI.RVLTAR.TV | |
| Retrocopy | DNSSAVLLQWQEKALAAGGVGSIVRVLTARETV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 1 .23 RPM | 43 .48 RPM |
| SRP007412_brain_prefrontal_cortex | 1 .59 RPM | 44 .82 RPM |
| SRP007412_cerebellum | 0 .45 RPM | 23 .44 RPM |
| SRP007412_heart | 0 .88 RPM | 22 .67 RPM |
| SRP007412_kidney | 1 .76 RPM | 16 .55 RPM |
| SRP007412_liver | 1 .15 RPM | 9 .46 RPM |
| SRP007412_testis | 1 .21 RPM | 119 .94 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000016540 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000006730 | 4 retrocopies | |
| Felis catus | ENSFCAG00000028753 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000020628 | 2 retrocopies |
retro_mmul_1650, retro_mmul_623 ,
|
| Mustela putorius furo | ENSMPUG00000013924 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000002997 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000013936 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000021362 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000014317 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000007907 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000008398 | 1 retrocopy |