RetrogeneDB ID: | retro_mmul_434 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 1:153571316..153571600(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COMMD8 | ||
| Ensembl ID: | ENSMMUG00000021777 | ||
| Aliases: | None | ||
| Description: | COMM domain-containing protein 8 [Source:RefSeq peptide;Acc:NP_001247814] |
| Percent Identity: | 57.14 % |
| Parental protein coverage: | 51.37 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 3 |
| Parental | LWRLQKLPAELGPQLLHKIIDGI-CGRAYPVYQDYHTVWESEEWMHVLEDIAK-FFKAVVG-KNLSDEEI |
| LW.LQK.PAE...QL.HK.IDGI.C..A....QD.H.V..S.E..H.L..I...F.K...G.K..S.E.I | |
| Retrocopy | LWQLQKQPAEPNSQLIHKVIDGI<CVWAHALCQD*HSVSVSKEGTHFLKGINR>F*KPINGEKCMSNEKI |
| Parental | FQQLNQLN-SFHQETIMKCVKSRKDEIK |
| ..QLNQLN.SFHQE.IMKC.K.RKDEIK | |
| Retrocopy | EKQLNQLN<SFHQEIIMKCLKCRKDEIK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 4 .03 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 1 .90 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 4 .39 RPM |
| SRP007412_heart | 0 .06 RPM | 2 .36 RPM |
| SRP007412_kidney | 0 .35 RPM | 13 .97 RPM |
| SRP007412_liver | 0 .00 RPM | 1 .86 RPM |
| SRP007412_testis | 0 .00 RPM | 4 .07 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000001348 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000020257 | 3 retrocopies | |
| Felis catus | ENSFCAG00000023811 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000011376 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000021777 | 1 retrocopy |
retro_mmul_434 ,
|
| Ochotona princeps | ENSOPRG00000000739 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000001221 | 1 retrocopy |