RetrogeneDB ID: | retro_mmul_2171 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 7:104764733..104764996(+) | ||
| Located in intron of: | ENSMMUG00000011997 | ||
Retrocopy information | Ensembl ID: | ENSMMUG00000001281 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FKBP1B | ||
| Ensembl ID: | ENSMMUG00000012341 | ||
| Aliases: | None | ||
| Description: | peptidyl-prolyl cis-trans isomerase FKBP1B [Source:RefSeq peptide;Acc:NP_001253652] |
| Percent Identity: | 68.48 % |
| Parental protein coverage: | 84.26 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | KKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATG |
| KK.Q.CVVHYTGM.QNG.KFD.S.DRN...KF..G.QEVI.GFEE...QMSLGQ..KLTC.PDV.YGA.G | |
| Retrocopy | KKSQMCVVHYTGMFQNGNKFDLSQDRN---KFKTGEQEVINGFEEDIVQMSLGQKVKLTCIPDVSYGAPG |
| Parental | HPGVIPPNATL-IFDVELLNLE |
| ...VIPP.ATL..FD.ELLN.E | |
| Retrocopy | FSCVIPPSATL<VFDRELLNSE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 7 .28 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .16 RPM | 16 .50 RPM |
| SRP007412_cerebellum | 0 .13 RPM | 4 .65 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .06 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .04 RPM |
| SRP007412_testis | 0 .04 RPM | 0 .15 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1329 |
| Pan troglodytes | retro_ptro_906 |
| Gorilla gorilla | retro_ggor_1036 |
| Pongo abelii | retro_pabe_1105 |
| Callithrix jacchus | retro_cjac_696 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000007700 | 1 retrocopy | |
| Ciona savignyi | ENSCSAVG00000006859 | 1 retrocopy | |
| Equus caballus | ENSECAG00000015664 | 1 retrocopy | |
| Homo sapiens | ENSG00000119782 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000010689 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000007405 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000009587 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000012341 | 1 retrocopy |
retro_mmul_2171 ,
|
| Macaca mulatta | ENSMMUG00000015996 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016512 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000000800 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000012604 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000011708 | 1 retrocopy |