RetrogeneDB ID: | retro_mmul_2038 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 6:127046654..127047006(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FXN | ||
| Ensembl ID: | ENSMMUG00000000357 | ||
| Aliases: | None | ||
| Description: | frataxin, mitochondrial [Source:RefSeq peptide;Acc:NP_001247670] |
| Percent Identity: | 55.46 % |
| Parental protein coverage: | 54.29 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | VYLMNLRKSGTLGHPGSLDDTTYERLAEETLDSLAEF---FEDLADKPYTFEDYDV-SFGSGVLTVKLGG |
| V.LMNL.K..T.....SL...TY.RLA.E....LA.....F..L..K.YT.E..DV..FGS..L..KL.G | |
| Retrocopy | VHLMNLMKMLTWCGQSSLGKATYKRLA-EMTNVLADWLFVF*KLKNKSYTVEI*DV>KFGSSILVTKLCG |
| Parental | DLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDG-VSLHELL |
| D.G.Y..NKQTPN.QIW.S.PS.GPK.YDW.G.NWVYSH...V.LHELL | |
| Retrocopy | DRGAYRMNKQTPNNQIWFSLPSNGPKNYDWNGNNWVYSHNNCVPLHELL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 4 .48 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 2 .62 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 4 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 9 .83 RPM |
| SRP007412_kidney | 0 .00 RPM | 7 .28 RPM |
| SRP007412_liver | 0 .00 RPM | 4 .79 RPM |
| SRP007412_testis | 0 .00 RPM | 3 .58 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Gorilla gorilla | retro_ggor_2203 |
| Equus caballus | retro_ecab_311 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006915 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000005107 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000001695 | 4 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000024066 | 3 retrocopies | |
| Equus caballus | ENSECAG00000019174 | 1 retrocopy | |
| Homo sapiens | ENSG00000165060 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000007636 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000000357 | 2 retrocopies |
retro_mmul_2038 , retro_mmul_826,
|
| Mustela putorius furo | ENSMPUG00000009619 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000059363 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000031105 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000015213 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000010336 | 4 retrocopies |