RetrogeneDB ID: | retro_mmul_2029 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 6:99282488..99282931(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMMUG00000007850 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.10922 | ||
| Ensembl ID: | ENSMMUG00000028767 | ||
| Aliases: | None | ||
| Description: | eukaryotic translation initiation factor 3 subunit K [Source:RefSeq peptide;Acc:NP_001244620] |
| Percent Identity: | 80.67 % |
| Parental protein coverage: | 68.35 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQIL |
| M..FEQMRA.VGKLLKGI.R.NPE.LATLE..VE.Q.KENAYDLEAN.AVLKLYQ.NPAFFQTT.TAQI. | |
| Retrocopy | MLIFEQMRASVGKLLKGINRNNPEKLATLECSVEMQVKENAYDLEANPAVLKLYQSNPAFFQTTITAQIQ |
| Parental | LKALTNLPHTDFTLCKCMIDQAHQEERP-IRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVR |
| LKALTNLPHT.F.LCKCMI.QAHQEE.P.IR.ILYL.D.LET..FQAFWQALDENMDLLEGITGFEDSV. | |
| Retrocopy | LKALTNLPHTNFMLCKCMIGQAHQEEWP<IRCILYLKD-LETSLFQAFWQALDENMDLLEGITGFEDSV* |
| Parental | KFICHVVGIT |
| ..IC.V.GIT | |
| Retrocopy | MLICPVMGIT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 14 .23 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .08 RPM | 34 .35 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 10 .59 RPM |
| SRP007412_heart | 0 .00 RPM | 28 .62 RPM |
| SRP007412_kidney | 0 .00 RPM | 15 .02 RPM |
| SRP007412_liver | 0 .00 RPM | 24 .98 RPM |
| SRP007412_testis | 0 .00 RPM | 18 .77 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3224 |
| Pan troglodytes | retro_ptro_2176 |
| Gorilla gorilla | retro_ggor_2192 |
| Pongo abelii | retro_pabe_2673 |
| Macaca mulatta | retro_mmul_2098 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Echinops telfairi | ENSETEG00000007594 | 3 retrocopies | |
| Homo sapiens | ENSG00000178982 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000016808 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000010217 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000028767 | 2 retrocopies |
retro_mmul_1478, retro_mmul_2029 ,
|
| Monodelphis domestica | ENSMODG00000013314 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000026260 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025857 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000010934 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000005313 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000007001 | 1 retrocopy |