RetrogeneDB ID: | retro_mmul_1968 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 5:109297187..109297382(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMMUG00000003422 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COX7AH | ||
| Ensembl ID: | ENSMMUG00000000250 | ||
| Aliases: | COX7AH, COX7A1 | ||
| Description: | cytochrome c oxidase subunit 7AH [Source:RefSeq peptide;Acc:NP_001035368] |
Retrocopy-Parental alignment summary:
>retro_mmul_1968
AGAACCATAAGCACTACTTCCCACAGGCATTTTAAAAATAAAGTTCCAGAGAAACAAAAACTGTTCCAGGAGGATGATGG
AATTCCACTGTATCTAAAGGGTGGGATATTTCATGTCCTCCTGTATAGAGCCACCATGATTCTTACAGTTGGTGGAACAG
CATATGCCATGTATCAGCTGTCTGTGGCTGCATTT
ORF - retro_mmul_1968 Open Reading Frame is conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 56.92 % |
| Parental protein coverage: | 82.28 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
Retrocopy - Parental Gene Alignment:
| Parental | RSFSSTARNRFQNRVPEKQKLFQEDNDIPLYLKGGFVDNILYRVTMALGLGGSVYSLYCLGWASF |
| R..S.T....F.N.VPEKQKLFQED..IPLYLKGG.....LYR.TM.L..GG..Y..Y.L..A.F | |
| Retrocopy | RTISTTSHRHFKNKVPEKQKLFQEDDGIPLYLKGGIFHVLLYRATMILTVGGTAYAMYQLSVAAF |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .56 RPM | 2 .47 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .16 RPM | 5 .71 RPM |
| SRP007412_cerebellum | 0 .90 RPM | 2 .58 RPM |
| SRP007412_heart | 0 .12 RPM | 127 .19 RPM |
| SRP007412_kidney | 1 .53 RPM | 15 .73 RPM |
| SRP007412_liver | 0 .28 RPM | 31 .59 RPM |
| SRP007412_testis | 1 .58 RPM | 3 .51 RPM |
Macaca mulatta was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_mmul_1968 retrocopy.
Macaca mulatta was not studied using FANTOM5 data.
retro_mmul_1968 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_mmul_1968 has 0 orthologous retrocopies within eutheria group .Parental genes homology:
Parental genes homology involve 7 parental genes, and 9 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000012840 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000007654 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000012331 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000000250 | 3 retrocopies |
retro_mmul_1665, retro_mmul_1968 , retro_mmul_2489,
|
| Macaca mulatta | ENSMMUG00000016278 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000025577 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000010888 | 1 retrocopy |