RetrogeneDB ID: | retro_mmul_1206 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 15:106156392..106156832(-) | ||
| Located in intron of: | ENSMMUG00000016343 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | YRDC | ||
| Ensembl ID: | ENSMMUG00000005372 | ||
| Aliases: | None | ||
| Description: | YrdC domain-containing protein, mitochondrial [Source:UniProtKB/TrEMBL;Acc:H9F8J3] |
| Percent Identity: | 75.68 % |
| Parental protein coverage: | 54.28 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | VRVPEGLLKDLLPGPVTLVMERSEELNKDLN-PFTPLV-GIRIPDHAFMQDLAQMFEGPLALTSANLSSQ |
| .RVP..LLKDLLPGPV...MERSEELNKD.N.P.TPL..GI.IPD.AFM.DLA.M.E.PLALTSANLSSQ | |
| Retrocopy | MRVPQELLKDLLPGPVPPEMERSEELNKDPN>PLTPLI>GIQIPDYAFM*DLAKMYEHPLALTSANLSSQ |
| Parental | ASSLNVEEFRDLWPQLSLVIDGGQIGGGQSPECRLGSTVVDLSVPGKFGIIRPGCALESTTAILQQKYGL |
| .SSLNV.E..DLWPQLSLVIDGG.....Q.PEC.LGSTVVDLSV..K.GII.PGC.LEST.A.LQQ.YGL | |
| Retrocopy | DSSLNVMEL*DLWPQLSLVIDGGLTRDSQTPECCLGSTVVDLSVHRKLGIIHPGCVLESTLAFLQQRYGL |
| Parental | LPSHASYL |
| LPSHASYL | |
| Retrocopy | LPSHASYL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 7 .62 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 9 .92 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 7 .49 RPM |
| SRP007412_heart | 0 .00 RPM | 2 .65 RPM |
| SRP007412_kidney | 0 .00 RPM | 5 .40 RPM |
| SRP007412_liver | 0 .00 RPM | 6 .49 RPM |
| SRP007412_testis | 0 .08 RPM | 6 .03 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4289 |
| Pongo abelii | retro_pabe_3495 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001173 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000009111 | 2 retrocopies | |
| Equus caballus | ENSECAG00000022522 | 1 retrocopy | |
| Felis catus | ENSFCAG00000011018 | 1 retrocopy | |
| Homo sapiens | ENSG00000196449 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000007619 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000005068 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000011953 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000000955 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000005372 | 2 retrocopies |
retro_mmul_1206 , retro_mmul_1662,
|
| Nomascus leucogenys | ENSNLEG00000011665 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000030474 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000001523 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000000557 | 4 retrocopies | |
| Tupaia belangeri | ENSTBEG00000008863 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000005555 | 3 retrocopies |