RetrogeneDB ID: | retro_mluc_1445 | ||
Retrocopy location | Organism: | Microbat (Myotis lucifugus) | |
| Coordinates: | GL429839:4901128..4901335(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PCBD2 | ||
| Ensembl ID: | ENSMLUG00000012638 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 76.06 % |
| Parental protein coverage: | 69.61 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | NAIYKEFSFKNFNQAFGFMSRVALQAEKMNHHPEWFNAYNKVQITLTSHDCGQLTKRDVKLAKFIEKAAA |
| .AI.K.F.FKNFNQAFGF.SRVAL.AEK..H..EWFN.Y.K.QITLTSH.CG.LTKR.VKLA.FIEKAAA | |
| Retrocopy | DAIHKQF-FKNFNQAFGFLSRVAL*AEKISHW-EWFNVYKKAQITLTSHGCGGLTKRGVKLATFIEKAAA |
| Parental | S |
| S | |
| Retrocopy | S |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000019125 | 2 retrocopies | |
| Equus caballus | ENSECAG00000015810 | 2 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000007051 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000016658 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000003784 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000012638 | 1 retrocopy |
retro_mluc_1445 ,
|
| Myotis lucifugus | ENSMLUG00000016074 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000014351 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000000384 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000016874 | 3 retrocopies |