RetrogeneDB ID: | retro_meug_1182 | ||
Retrocopy location | Organism: | Wallaby (Macropus eugenii) | |
| Coordinates: | Scaffold31951:38588..38922(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RAB28 | ||
| Ensembl ID: | ENSMEUG00000006792 | ||
| Aliases: | None | ||
| Description: | RAB28, member RAS oncogene family [Source:HGNC Symbol;Acc:9768] |
| Percent Identity: | 73.68 % |
| Parental protein coverage: | 50.68 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | IVKKVNEESETQPLVALVGNKIDLEHMRTVKPDKHLRFCQENGLSSHFVSAKTGDSV-FLCFQRVAAEIL |
| .VKKV.EESETQPLVALV.NKI.LEHMRT.K.DK.LRFCQEN.LSSHFVSAKTGD......F.......L | |
| Retrocopy | MVKKVKEESETQPLVALVDNKINLEHMRTLKHDKDLRFCQENVLSSHFVSAKTGDYL<SCVFRELLLKFL |
| Parental | G-IKLNKAEIEQSQRVVKADIVNYNQEPVSKTVNSPRSSMCTIQ |
| G.IKLNKAEIE.SQ.V..AD.VNY.QEPVSKTVN..RSSMCTIQ | |
| Retrocopy | G<IKLNKAEIEESQKVMQADTVNYDQEPVSKTVNLSRSSMCTIQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009344 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000001523 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000012136 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000007750 | 4 retrocopies | |
| Dipodomys ordii | ENSDORG00000012378 | 1 retrocopy | |
| Homo sapiens | ENSG00000157869 | 7 retrocopies | |
| Gorilla gorilla | ENSGGOG00000024190 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000006792 | 4 retrocopies | |
| Macaca mulatta | ENSMMUG00000022025 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000016243 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000014610 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000015920 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000017074 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000009274 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000022358 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000004135 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000010939 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000003622 | 1 retrocopy |