RetrogeneDB ID: | retro_mdom_341 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 1:221810928..221811287(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UBE2A | ||
| Ensembl ID: | ENSMODG00000010209 | ||
| Aliases: | None | ||
| Description: | ubiquitin-conjugating enzyme E2A [Source:HGNC Symbol;Acc:12472] |
| Percent Identity: | 57.02 % |
| Parental protein coverage: | 78.95 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | APSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRW |
| A.SEN.IM....V..G..GTPFED..FKL..EFT.EY.NKP..VRF....FH...Y.DG.IC.DILQN.W | |
| Retrocopy | ALSENSIMM*IRVVLGLKGTPFEDVIFKLRREFTKEYLNKPSIVRFAPRIFHTKIYEDGNICPDILQNHW |
| Parental | SPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQ-ENKREYEKRVSAIVE |
| .PTYDVSSI..S..SLL..P.PNS.ANS...QL.Q..NK.EY....S.I.. | |
| Retrocopy | NPTYDVSSISISLRSLLNGPDPNSVANSWDTQL*Q<GNK*EYQAVTSEIAQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000001079 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000005098 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000011908 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000007060 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000003026 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000010209 | 1 retrocopy |
retro_mdom_341 ,
|
| Monodelphis domestica | ENSMODG00000014209 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000016739 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000024335 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000005045 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000012621 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000000888 | 1 retrocopy |