RetrogeneDB ID: | retro_mdom_1113 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 3:144041471..144041711(-) | ||
| Located in intron of: | ENSMODG00000005451 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | EIF1B | ||
| Ensembl ID: | ENSMODG00000011056 | ||
| Aliases: | None | ||
| Description: | eukaryotic translation initiation factor 1B [Source:HGNC Symbol;Acc:30792] |
| Percent Identity: | 82.5 % |
| Parental protein coverage: | 70.8 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | RIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIV |
| RIQ....RKTL.TVQGIAD.Y.KKKLVKAFKKKFACNGTVI.HPEY..VIQL.GDQR.NI.QFLLEVGIV | |
| Retrocopy | RIQPWKDRKTLHTVQGIADNYEKKKLVKAFKKKFACNGTVIKHPEYSKVIQL*GDQRRNISQFLLEVGIV |
| Parental | KEEQLKVHGF |
| KE.QLKVHGF | |
| Retrocopy | KEKQLKVHGF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dipodomys ordii | ENSDORG00000013689 | 4 retrocopies | |
| Echinops telfairi | ENSETEG00000017295 | 5 retrocopies | |
| Microcebus murinus | ENSMICG00000013223 | 5 retrocopies | |
| Macaca mulatta | ENSMMUG00000017704 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000011056 | 2 retrocopies |
retro_mdom_1113 , retro_mdom_1382,
|
| Mus musculus | ENSMUSG00000006941 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000025224 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000012168 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000013185 | 6 retrocopies | |
| Tarsius syrichta | ENSTSYG00000006338 | 3 retrocopies |