RetrogeneDB ID: | retro_itri_1597 | ||
Retrocopy location | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393564.1:1641646..1641874(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | EIF1B | ||
| Ensembl ID: | ENSSTOG00000012168 | ||
| Aliases: | None | ||
| Description: | eukaryotic translation initiation factor 1B [Source:HGNC Symbol;Acc:30792] |
| Percent Identity: | 94.74 % |
| Parental protein coverage: | 67.26 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | RNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQ |
| ..GRKTLTTVQGIADDYDKKKLVKAFKKKFACNG.VIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQ | |
| Retrocopy | QDGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGSVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQ |
| Parental | LKVHGF |
| LKVH.F | |
| Retrocopy | LKVHRF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dipodomys ordii | ENSDORG00000013689 | 4 retrocopies | |
| Echinops telfairi | ENSETEG00000017295 | 5 retrocopies | |
| Microcebus murinus | ENSMICG00000013223 | 5 retrocopies | |
| Macaca mulatta | ENSMMUG00000017704 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000011056 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000006941 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000025224 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000002719 | 15 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000012168 | 1 retrocopy |
retro_itri_1597 ,
|
| Tupaia belangeri | ENSTBEG00000013185 | 6 retrocopies | |
| Tarsius syrichta | ENSTSYG00000006338 | 3 retrocopies |