RetrogeneDB ID: | retro_mdom_1105 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 3:122238737..122239130(-) | ||
| Located in intron of: | ENSMODG00000003756 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFB5 | ||
| Ensembl ID: | ENSMODG00000021300 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa [Source:HGNC Symbol;Acc:7700] |
| Percent Identity: | 62.96 % |
| Parental protein coverage: | 68.21 % |
| Number of stop codons detected: | 6 |
| Number of frameshifts detected: | 2 |
| Parental | VRHSGGHGKR-MFLIKASEFYDKRFLKLLRFYLLLTGIPVAVGITFVNIFIGEAELAEIPDGYVPEHWE- |
| V.HSGGH.K..MFLI....FYD.R.L.LLRFYLL.TGI.VA.GIT..NIFIG..EL.EI..GY.P...E. | |
| Retrocopy | VLHSGGHVKK>MFLITYYGFYDNRSLMLLRFYLLFTGILVAIGITLLNIFIGKDELTEITEGYIP*N*E< |
| Parental | YYKHPITRWIARYVYEPPEKNYERTMAILQVEAEKADLRLKLQATDRLMRERGDGPWFHYPTVDK |
| ..K.PITRWIA.YVYEP.EKN.ER.M.ILQ..AEK.D..LK...T.RLM...G...WFHYPT.DK | |
| Retrocopy | NFKYPITRWIACYVYEPFEKNDERKMTILQL*AEKFDPMLKF*ETKRLM**VGS--WFHYPTIDK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000002684 | 1 retrocopy | |
| Equus caballus | ENSECAG00000000682 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000019363 | 1 retrocopy | |
| Homo sapiens | ENSG00000136521 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000014166 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000000999 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000009746 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000021300 | 1 retrocopy |
retro_mdom_1105 ,
|
| Nomascus leucogenys | ENSNLEG00000005842 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000014493 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000015649 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000004286 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000006918 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000011764 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000010557 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000008910 | 3 retrocopies |