RetrogeneDB ID: | retro_itri_800 | ||
Retrocopy location | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393325.1:6152809..6153058(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NUTF2 | ||
| Ensembl ID: | ENSSTOG00000002878 | ||
| Aliases: | None | ||
| Description: | nuclear transport factor 2 [Source:HGNC Symbol;Acc:13722] |
| Percent Identity: | 83.13 % |
| Parental protein coverage: | 65.35 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLTSLPFQKIQHSITA |
| MG..P.WEQIGSSFIQHYYQL.DNDRT.LGAIYID.S.L.WEGQQFQG.AAIVEKL.SLPFQK.Q..ITA | |
| Retrocopy | MGNRPVWEQIGSSFIQHYYQLLDNDRTELGAIYIDTSHLKWEGQQFQGTAAIVEKLSSLPFQKLQPRITA |
| Parental | QDHQPTPDSCIIS |
| QDHQPT.DSCIIS | |
| Retrocopy | QDHQPTLDSCIIS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017548 | 5 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000003059 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000023925 | 5 retrocopies | |
| Macropus eugenii | ENSMEUG00000009874 | 11 retrocopies | |
| Myotis lucifugus | ENSMLUG00000025175 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000012038 | 6 retrocopies | |
| Monodelphis domestica | ENSMODG00000005517 | 6 retrocopies | |
| Mus musculus | ENSMUSG00000008450 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000006322 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000006100 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000030295 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000002878 | 1 retrocopy |
retro_itri_800 ,
|
| Drosophila melanogaster | FBgn0031145 | 1 retrocopy |