RetrogeneDB ID: | retro_itri_753 | ||
Retrocopy location | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393318.1:5972437..5972657(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL36A | ||
| Ensembl ID: | ENSSTOG00000027251 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L36a [Source:HGNC Symbol;Acc:10359] |
| Percent Identity: | 59.21 % |
| Parental protein coverage: | 50.7 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | KKCGKHQPHKVTQYKKGKDSL-YAQGKRRYDRKQS--GYGGQTKPIFRKKAKTT-KKIVLRLECVEPNCR |
| .K...HQPH....YKK..DSL.YAQGKR..D.KQ...G.G.QTKP.F.K..K...KK.VLR.E.VEPN.R | |
| Retrocopy | EKSDEHQPHRASSYKKD*DSL<YAQGKRLNDQKQKQRGCGKQTKPVFQKASKSE<KKSVLRHERVEPNYR |
| Parental | SKRMLA |
| SKRM.A | |
| Retrocopy | SKRMQA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |