RetrogeneDB ID: | retro_ggor_2834 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 9:13245228..13245580(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SSB | ||
| Ensembl ID: | ENSGGOG00000023471 | ||
| Aliases: | None | ||
| Description: | Sjogren syndrome antigen B (autoantigen La) [Source:HGNC Symbol;Acc:11316] |
| Percent Identity: | 70.59 % |
| Parental protein coverage: | 51.98 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | VFFRDDYFAKKNEERKQNKVEAKLRAKQEQEAKQKLEEDAEMKSLEEK-IGCLLKFSGDLDDQTCREDLH |
| ..F...YFA.K.EE..QN..E.KLRAK.EQE.K.KL..DAEMKSLE.K..GCLLKF.GDLD.QTCRE..H | |
| Retrocopy | ILFKEYYFAEKSEESRQNNMEDKLRAKEEQEEK*KLH-DAEMKSLEKK>TGCLLKFLGDLDEQTCREGSH |
| Parental | ILFSNHGEIKWIDFVRGAKEGIILFKEKPRKHLGKAKDANNXNLQLRNK |
| ILFSNHGE.KW.D.VRGAKEGII.FKEK....LGKAKDANN.NLQL..K | |
| Retrocopy | ILFSNHGELKWTDVVRGAKEGIIRFKEKVEEALGKAKDANNGNLQLTKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 10 .98 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 7 .84 RPM |
| SRP007412_heart | 0 .00 RPM | 2 .69 RPM |
| SRP007412_kidney | 0 .00 RPM | 13 .66 RPM |
| SRP007412_liver | 0 .00 RPM | 5 .91 RPM |
| SRP007412_testis | 0 .00 RPM | 11 .60 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000007763 | 5 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000013450 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000004614 | 1 retrocopy | |
| Homo sapiens | ENSG00000138385 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000011507 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000023471 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000000867 | 3 retrocopies | |
| Macropus eugenii | ENSMEUG00000001650 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000016316 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000023051 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000008227 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000004958 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000029768 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000012919 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000012620 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000007998 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000009056 | 4 retrocopies | |
| Tursiops truncatus | ENSTTRG00000002152 | 2 retrocopies |