RetrogeneDB ID: | retro_ggor_2832 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 9:9105514..9105688(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ENSG00000215241 | ||
| Ensembl ID: | ENSGGOG00000027169 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 51.72 % |
| Parental protein coverage: | 63.04 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | SNVESKKWVREGSPQRNMKYFYTEVSRSGQAQWLTPVIPALWEAEAGGSPEVRSSRPA |
| SNV.................F.TE....GQ..W.TPVIP.LWEAEA.G.PEVRSSRPA | |
| Retrocopy | SNVSMNSLTDSSGRFSRSSWFETEKNNFGQMRWFTPVIPTLWEAEARGLPEVRSSRPA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .10 RPM | 0 .05 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .35 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .16 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .12 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .05 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000020103 | 14 retrocopies | |
| Gorilla gorilla | ENSGGOG00000023636 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027169 | 1 retrocopy |
retro_ggor_2832 ,
|