RetrogeneDB ID: | retro_cjac_3737 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | ACFV01197742.1:1185..1362(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCJAG00000020103 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 55.93 % |
| Parental protein coverage: | 62.77 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | VSPFRDQSGQHSETPQASQAWWLMPVIPALWEDEAGGSPEVRSSRPAWPTWQNPISVKN |
| ..P..D.S...........A.WLMPVIPALWE...GGSPEVRS.RPAWPT...P.S.KN | |
| Retrocopy | LQPRADSSKKLLPNSVCDWAHWLMPVIPALWEAKVGGSPEVRSWRPAWPT*LSPVSTKN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 0 .00 RPM |
| SRP051959_heart | 0 .00 RPM | 0 .00 RPM |
| SRP051959_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP051959_liver | 0 .00 RPM | 0 .02 RPM |
| SRP051959_lung | 0 .00 RPM | 0 .00 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 0 .00 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 0 .00 RPM |
| SRP051959_spleen | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000020103 | 14 retrocopies | |
| Callithrix jacchus | ENSCJAG00000034129 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000027169 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000006176 | 2 retrocopies |