RetrogeneDB ID: | retro_ggor_2805 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 9:58076821..58077100(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | H3F3B | ||
| Ensembl ID: | ENSGGOG00000022928 | ||
| Aliases: | None | ||
| Description: | H3 histone, family 3B (H3.3B) [Source:HGNC Symbol;Acc:4765] |
| Percent Identity: | 63.44 % |
| Parental protein coverage: | 65.44 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 0 |
| Parental | APRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRF |
| AP.K.LAT.A..KSAPSTG..KKP..YR...VAL.EIR.YQKST..LI.KL.FQ.L..EIA.DFKTDL.. | |
| Retrocopy | APGKHLATNAFPKSAPSTGEMKKP*HYRLDIVALHEIRCYQKSTKFLICKLSFQYLILEIA*DFKTDLCC |
| Parental | QSAAIGA----LQEASEAYLVGL |
| QS.AIG.....L.EAS..Y.VGL | |
| Retrocopy | QSTAIGSK*GLL*EASVVYHVGL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 161 .99 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 335 .67 RPM |
| SRP007412_heart | 0 .00 RPM | 65 .20 RPM |
| SRP007412_kidney | 0 .00 RPM | 187 .19 RPM |
| SRP007412_liver | 0 .00 RPM | 175 .20 RPM |
| SRP007412_testis | 0 .00 RPM | 607 .82 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Pan troglodytes | retro_ptro_2834 |
| Pongo abelii | retro_pabe_3420 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000009661 | 10 retrocopies | |
| Gorilla gorilla | ENSGGOG00000022526 | 11 retrocopies | |
| Gorilla gorilla | ENSGGOG00000022928 | 7 retrocopies |
retro_ggor_1964, retro_ggor_2181, retro_ggor_2198, retro_ggor_2357, retro_ggor_2805 , retro_ggor_2905, retro_ggor_2987,
|
| Loxodonta africana | ENSLAFG00000021624 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000015447 | 10 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000024644 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000008636 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000024226 | 8 retrocopies | |
| Tupaia belangeri | ENSTBEG00000006177 | 13 retrocopies |