RetrogeneDB ID: | retro_ggor_268 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 1:95203898..95204338(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ZFAND1 | ||
| Ensembl ID: | ENSGGOG00000023665 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 71.05 % |
| Parental protein coverage: | 55.19 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 3 |
| Parental | QHTSYPCSFKDCAERELVAVICPYCEKNFCLRHRHQSDHECEKLEIPKPRMAATQKLVKDIIDSKTGETA |
| .H..YPCSFKD..E..LVAVI.PYCE.NFCLRH.HQSDH.CEKLEIPKP.M.ATQ.LVKD.IDSKTGETA | |
| Retrocopy | KHKFYPCSFKDRVEK-LVAVIRPYCENNFCLRHHHQSDHKCEKLEIPKPYMTATQ*LVKD-IDSKTGETA |
| Parental | SKRRKG-AKNSETAAKV-ALMKLKMHADGDKSLPQTERIYFQVFLPKGSKEKSKPMFFC-HRWSIGKAID |
| SK..KG..KNSETAAK.....KL...ADGD.SLPQ.E.I.FQV.LPKGSKEK.KPMFF..H..SI.K... | |
| Retrocopy | SKQGKG>TKNSETAAKE<TALKLRIYADGDISLPQEETICFQVLLPKGSKEKGKPMFFS<HG*SIRKVTN |
| Parental | FAASLARLKNDN |
| FA.SLA.LK.DN | |
| Retrocopy | FATSLASLKDDN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 7 .29 RPM |
| SRP007412_cerebellum | 0 .08 RPM | 6 .54 RPM |
| SRP007412_heart | 0 .00 RPM | 1 .69 RPM |
| SRP007412_kidney | 0 .04 RPM | 10 .55 RPM |
| SRP007412_liver | 0 .05 RPM | 11 .11 RPM |
| SRP007412_testis | 0 .00 RPM | 8 .29 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_187 |
| Macaca mulatta | retro_mmul_394 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000014075 | 1 retrocopy | |
| Homo sapiens | ENSG00000104231 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000023665 | 1 retrocopy |
retro_ggor_268 ,
|
| Microcebus murinus | ENSMICG00000016889 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000002626 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000039795 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000002584 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000009813 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000015393 | 1 retrocopy |