RetrogeneDB ID: | retro_fcat_1027 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | B4:53170901..53171209(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DUXA | ||
| Ensembl ID: | ENSFCAG00000007545 | ||
| Aliases: | None | ||
| Description: | double homeobox A [Source:HGNC Symbol;Acc:32179] |
| Percent Identity: | 70.19 % |
| Parental protein coverage: | 62.73 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | NLSTETTPVNHRRSRTKFTQDQLKILIKAFDKNPYPGYATKQKLALEVNTEESRIQIWFQNRRARH--QK |
| N....T...NHR.S.TKFT.DQLKILIKAFD.N.YPGYA.KQKLALEVNTEES.IQIWFQN.RAR...QK | |
| Retrocopy | NSPNKTIAMNHRHSHTKFTEDQLKILIKAFDQNFYPGYAIKQKLALEVNTEESKIQIWFQN*RARYQGQK |
| Parental | KSEP-DEDLESSQDQDHLEEEIQSREDRRSRTNY |
| ...P.D..LE.SQDQDH.E..IQSREDR..RT.Y | |
| Retrocopy | NQNP<DKELELSQDQDHPEKDIQSREDRWCRTCY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 0 .00 RPM |
| SRP017611_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP017611_liver | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000025505 | 1 retrocopy | |
| Felis catus | ENSFCAG00000007545 | 1 retrocopy |
retro_fcat_1027 ,
|
| Homo sapiens | ENSG00000258873 | 5 retrocopies | |
| Gorilla gorilla | ENSGGOG00000005650 | 7 retrocopies | |
| Loxodonta africana | ENSLAFG00000030167 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000007788 | 5 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000010886 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000011331 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000010457 | 8 retrocopies | |
| Pan troglodytes | ENSPTRG00000028871 | 5 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000003020 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000005321 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000014223 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000014200 | 2 retrocopies |