RetrogeneDB ID: | retro_etel_2129 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_70976:880..1108(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSETEG00000018816 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | KXD1 | ||
| Ensembl ID: | ENSETEG00000003390 | ||
| Aliases: | None | ||
| Description: | KxDL motif containing 1 [Source:HGNC Symbol;Acc:28420] |
| Percent Identity: | 77.92 % |
| Parental protein coverage: | 71.96 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | DDVNAIILAQKNMLDRFEKTNEMLLNFNNLSSARLQQMNERFLHHTRTLVEMKRDLDSIFRRVRTLKGKL |
| DDV..I.LAQKNMLDR.EK.NEMLLNF.NLSSA.LQQMNE..LHHT.TLVE.KRDLD.I..R.RTLKG.L | |
| Retrocopy | DDVHTITLAQKNMLDRLEKANEMLLNFKNLSSAHLQQMNEHSLHHTCTLVEVKRDLDGI-GRMRTLKGEL |
| Parental | ARQHPEA |
| A.QHPEA | |
| Retrocopy | AQQHPEA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000010545 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000003390 | 2 retrocopies |
retro_etel_1213, retro_etel_2129 ,
|
| Macropus eugenii | ENSMEUG00000013150 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000003489 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000055553 | 6 retrocopies | |
| Rattus norvegicus | ENSRNOG00000019971 | 2 retrocopies |