RetrogeneDB ID: | retro_etel_1516 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_276670:3430..3867(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CAPZA2 | ||
| Ensembl ID: | ENSETEG00000019711 | ||
| Aliases: | None | ||
| Description: | capping protein (actin filament) muscle Z-line, alpha 2 [Source:HGNC Symbol;Acc:1490] |
| Percent Identity: | 69.8 % |
| Parental protein coverage: | 51.75 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | DQVLITEHGDLGNGKFLDPKNRICFKFDHLRKEATDPRPYEAENAAESWRTSVETALRAYVKEHYPNGVC |
| .QV.ITEHGDLGNGKFL...NR..FKFDHLRKE...PRPY.AENA.ES.RTS.ET.LR.YVKEHYPNG.. | |
| Retrocopy | NQVVITEHGDLGNGKFLESPNRMFFKFDHLRKETIVPRPYKAENAVES*RTSLETSLRLYVKEHYPNGFF |
| Parental | TVYGKKIDGQQTIIACIESHQFQAKNFWNGRWRSEWKFTITPSTTQVVGILKIQVHYYE-DGNVQLVSHK |
| ...G.K.........CI.SHQFQAK.FWNG.W.SEWK.TITPST.Q.V.I.KIQVHYYE..GNVQLV.HK | |
| Retrocopy | PLHGNKRQANKK--PCI*SHQFQAKHFWNGHWQSEWKCTITPSTPQMVFIWKIQVHYYE<SGNVQLVTHK |
| Parental | DIQDSLTVS |
| DIQD.LT.S | |
| Retrocopy | DIQDPLTMS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000004925 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000007677 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000005771 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000016226 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000009063 | 5 retrocopies | |
| Echinops telfairi | ENSETEG00000019711 | 3 retrocopies |
retro_etel_1516 , retro_etel_2020, retro_etel_442,
|
| Gorilla gorilla | ENSGGOG00000012158 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000000707 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000007910 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000003591 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000017933 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000026942 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000024828 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000012657 | 2 retrocopies |