RetrogeneDB ID: | retro_ecab_616 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 23:23141938..23142129(-) | ||
| Located in intron of: | ENSECAG00000023609 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | YPEL2 | ||
| Ensembl ID: | ENSECAG00000018575 | ||
| Aliases: | None | ||
| Description: | yippee-like 2 (Drosophila) [Source:HGNC Symbol;Acc:18326] |
Retrocopy-Parental alignment summary:
>retro_ecab_616
ATGATAAAAATGACAAACTCAAAAACTTGCCAAGGGTATCTGCCAAATTGTCCTTGAATTTACTGCTGTATCCACTGGAA
AGCCCATTTAGCAAATCCTGCTGTGTTGATCTCCAAGTCCTTTCATGTTAGTCAACATCAAGCCCACCTCTTTAATTCTG
TGTGAAGGTGGCCTGTGGTCCAGGAGAGGAC
ORF - retro_ecab_616 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 63.08 % |
| Parental protein coverage: | 53.78 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
Retrocopy - Parental Gene Alignment:
| Parental | MVKMTRSKTFQAYLPSCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSV-VNVGCGPAEE |
| M.KMT.SKT.Q.YLP.C...Y.CIH..AHLAN...LISKSF..SQ..A.LFNSV.V.V.CGP.E. | |
| Retrocopy | MIKMTNSKTCQGYLPNCP*IYCCIHWKAHLANPAVLISKSFHVSQHQAHLFNSV<VKVACGPGED |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 8 .03 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 19 .89 RPM |
| SRP021940_embryo | 0 .00 RPM | 10 .56 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 17 .61 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 25 .20 RPM |
| SRP021940_testis | 0 .00 RPM | 10 .55 RPM |
Equus caballus was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_ecab_616 retrocopy.
Equus caballus was not studied using FANTOM5 data.
retro_ecab_616 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_ecab_616 has 1 orthologous retrocopies within eutheria group .| Species | RetrogeneDB ID |
|---|---|
| Callithrix jacchus | retro_cjac_597 |
Parental genes homology:
Parental genes homology involve 7 parental genes, and 8 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Equus caballus | ENSECAG00000018575 | 1 retrocopy |
retro_ecab_616 ,
|
| Otolemur garnettii | ENSOGAG00000029581 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000009791 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000001013 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000013138 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000005518 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000000381 | 1 retrocopy |