RetrogeneDB ID: | retro_cjac_597 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 1:102790711..102790905(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | YPEL1 | ||
| Ensembl ID: | ENSCJAG00000015755 | ||
| Aliases: | None | ||
| Description: | yippee-like 1 (Drosophila) [Source:HGNC Symbol;Acc:12845] |
Retrocopy-Parental alignment summary:
>retro_cjac_597
GTGATAAAAATGACAAACTCAATAACTTTCCCAGGTTATCTGCCAAATTGTCACTGAATTTATTGCTGTCTCCACTGCAA
ACCTCATTTAGCAAATCATGCTCTGTTGATCTTCAAGTTATCTTGTGTTAGTCAAAACAAAGATTGCCTCTTTAATTCTG
GGAGAATGTAGGCTGTGGCTCAGCAGAGGGGAGG
ORF - retro_cjac_597 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 57.58 % |
| Parental protein coverage: | 54.62 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
Retrocopy - Parental Gene Alignment:
| Parental | MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNS-VVNVGCGPAEER |
| ..KMT.S.TF..YLPNCH..Y.C.HC..HLANH..LI.K....SQ....LFNS...NVGCG.AE.R | |
| Retrocopy | VIKMTNSITFPGYLPNCH*IYCCLHCKPHLANHALLIFKLSCVSQNKDCLFNS<WENVGCGSAEGR |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 1 .77 RPM |
| SRP051959_heart | 0 .00 RPM | 3 .82 RPM |
| SRP051959_kidney | 0 .02 RPM | 2 .26 RPM |
| SRP051959_liver | 0 .00 RPM | 1 .58 RPM |
| SRP051959_lung | 0 .00 RPM | 4 .42 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 5 .64 RPM |
| SRP051959_skeletal_muscle | 0 .02 RPM | 2 .01 RPM |
| SRP051959_spleen | 0 .00 RPM | 3 .40 RPM |
Callithrix jacchus was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_cjac_597 retrocopy.
Callithrix jacchus was not studied using FANTOM5 data.
retro_cjac_597 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_cjac_597 has 1 orthologous retrocopies within eutheria group .| Species | RetrogeneDB ID |
|---|---|
| Equus caballus | retro_ecab_616 |
Parental genes homology:
Parental genes homology involve 6 parental genes, and 6 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000001397 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000015755 | 1 retrocopy |
retro_cjac_597 ,
|
| Dasypus novemcinctus | ENSDNOG00000024482 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000008187 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000013638 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000016725 | 1 retrocopy |