RetrogeneDB ID: | retro_ecab_292 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 14:8758221..8758640(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NUDT21 | ||
| Ensembl ID: | ENSECAG00000001043 | ||
| Aliases: | None | ||
| Description: | nudix (nucleoside diphosphate linked moiety X)-type motif 21 [Source:HGNC Symbol;Acc:13870] |
| Percent Identity: | 60.99 % |
| Parental protein coverage: | 59.47 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | LPHVLLLQLG-TTFFKLPG----GELNPGEDEVEGLKRLMTEILGRQDGVLQDWVI-DDCIGNWWRPNFE |
| .PHV.LLQLG.T.F..L.G....GE....E.E.EG.K.L.T.ILG...GV..DWV..D.C.GN...PN.E | |
| Retrocopy | VPHVFLLQLGTTFFKALGGELNPGEDEEEEGEFEGPKLLLTDILGG*SGVPPDWVM<DACTGNQ*GPNLE |
| Parental | PPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNF |
| PPQY.YIPAHITKP.E.KKLF..QLQEKAL...PKNYK..AAPLFEL...APG.GP....LP.LLSRF.F | |
| Retrocopy | PPQYAYIPAHITKPPEQKKLFFIQLQEKALSEAPKNYKSTAAPLFELSAQAPGCGPVSFHLPWLLSRFSF |
| Parental | I |
| . | |
| Retrocopy | L |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 38 .90 RPM |
| SRP021940_cerebellum | 0 .21 RPM | 19 .89 RPM |
| SRP021940_embryo | 0 .49 RPM | 55 .44 RPM |
| SRP021940_placental_villous | 0 .05 RPM | 29 .16 RPM |
| SRP021940_synovial_membrane | 0 .44 RPM | 27 .75 RPM |
| SRP021940_testis | 1 .41 RPM | 161 .33 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000016628 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000012724 | 3 retrocopies | |
| Equus caballus | ENSECAG00000001043 | 1 retrocopy |
retro_ecab_292 ,
|
| Erinaceus europaeus | ENSEEUG00000003402 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000028465 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000004968 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000003451 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000017224 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000009651 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000029848 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000007664 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000003701 | 2 retrocopies |