RetrogeneDB ID: | retro_ecab_239 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 10:41594730..41594996(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS24 | ||
| Ensembl ID: | ENSECAG00000016939 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S24 [Source:HGNC Symbol;Acc:10411] |
| Percent Identity: | 51.04 % |
| Parental protein coverage: | 72.52 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | RKFMTNRLLQRKQM-VIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDS |
| RKFMTN....RK.....D.L.PGKAT...TEI...LAK..KT..D.I..F.FRT.F...KTT.F.M.Y.. | |
| Retrocopy | RKFMTNECFDRKSR<IKDILYPGKATLFMTEI---LAKLSKTILDIILDFRFRTLF--DKTTEFDMVYVL |
| Parental | LDYAKKNEPKHRLARHGLYEKKKTSR |
| L...K.N.P..RLA.HGL..KK...R | |
| Retrocopy | LIRIK*N-PQQRLAKHGLSKKKNILR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .06 RPM | 363 .39 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 178 .44 RPM |
| SRP021940_embryo | 0 .03 RPM | 346 .31 RPM |
| SRP021940_placental_villous | 0 .05 RPM | 206 .78 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 221 .32 RPM |
| SRP021940_testis | 0 .00 RPM | 165 .93 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Equus caballus | ENSECAG00000016939 | 5 retrocopies | |
| Gadus morhua | ENSGMOG00000012595 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000005951 | 7 retrocopies | |
| Monodelphis domestica | ENSMODG00000025091 | 3 retrocopies | |
| Ornithorhynchus anatinus | ENSOANG00000006329 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000008090 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000010328 | 8 retrocopies |