RetrogeneDB ID: | retro_cpor_147 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_0:14513872..14514091(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HMGN3 | ||
| Ensembl ID: | ENSCPOG00000012407 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 87.67 % |
| Parental protein coverage: | 73.74 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | KKQSSENTEGKEGSKVTKQEPTRRSARLSTKPAPPKPEPKPRKTAIKKEPGTKINRGAKGKKEEKQEAGK |
| K..SSENTEGK.G.KVTKQEPTRRS.RLS.KPAP.KPEPKPRKTA.K.EPGTKINRGAKGKKEEKQEAGK | |
| Retrocopy | KRKSSENTEGKDGPKVTKQEPTRRSSRLSMKPAP*KPEPKPRKTATKEEPGTKINRGAKGKKEEKQEAGK |
| Parental | EGT |
| EGT | |
| Retrocopy | EGT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .23 RPM | 17 .77 RPM |
| SRP017611_kidney | 0 .21 RPM | 18 .22 RPM |
| SRP017611_liver | 0 .04 RPM | 8 .79 RPM |
| SRP040447_lung | 0 .08 RPM | 22 .35 RPM |
| SRP040447_skeletal_muscle | 0 .03 RPM | 8 .08 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000007015 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000012407 | 2 retrocopies |
retro_cpor_1399, retro_cpor_147 ,
|
| Felis catus | ENSFCAG00000028793 | 1 retrocopy | |
| Homo sapiens | ENSG00000118418 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000006910 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000004351 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000012377 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000016487 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000009611 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000018366 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000014353 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000015468 | 3 retrocopies | |
| Tarsius syrichta | ENSTSYG00000005238 | 3 retrocopies |