RetrogeneDB ID: | retro_cjac_978 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 12:48643557..48644001(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SPA17 | ||
| Ensembl ID: | ENSCJAG00000007961 | ||
| Aliases: | None | ||
| Description: | sperm autoantigenic protein 17 [Source:HGNC Symbol;Acc:11210] |
| Percent Identity: | 65.79 % |
| Parental protein coverage: | 96.75 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 3 |
| Parental | MSIPFSNTH-CRIPQGFGNLLEGLTREILREQPDNIP-AFAAAYFQSLLEKREKTNFDPAEWG-SKIDDR |
| MS.PFSNTH...IP.GFG.L.EG.T.EILREQ.DNI..AFAAAYF.S.LEKREK........G.....DR | |
| Retrocopy | MSVPFSNTH<LLIP*GFGSLPEGVTHEILREQLDNIQ<AFAAAYFESFLEKREKNHL*SSRMG<AQGQDR |
| Parental | FYNNHAFEKQEPPEKCDPKQEKSQISGKEEETPVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEVKKM |
| .Y.NHA.E.QEPP.KCDPKQEKS.I.G.EEETPVTILDSS.ED.E.EEV.AVKIQA.F.GH.AREEVK.M | |
| Retrocopy | LYSNHALEDQEPPDKCDPKQEKSPIPGEEEETPVTILDSSGEDREREEVSAVKIQAPFQGHTAREEVKRM |
| Parental | KTDSLQNEEDEE |
| .T.S....E... | |
| Retrocopy | ETVSNMKTEENK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .11 RPM | 0 .02 RPM |
| SRP051959_heart | 0 .18 RPM | 0 .21 RPM |
| SRP051959_kidney | 0 .11 RPM | 0 .60 RPM |
| SRP051959_liver | 0 .06 RPM | 0 .04 RPM |
| SRP051959_lung | 0 .13 RPM | 1 .59 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 0 .14 RPM |
| SRP051959_skeletal_muscle | 0 .04 RPM | 0 .13 RPM |
| SRP051959_spleen | 0 .27 RPM | 0 .23 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_696 |
| Pan troglodytes | retro_ptro_500 |
| Gorilla gorilla | retro_ggor_593 |
| Pongo abelii | retro_pabe_529 |
| Macaca mulatta | retro_mmul_2405 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000007961 | 1 retrocopy |
retro_cjac_978 ,
|
| Echinops telfairi | ENSETEG00000007789 | 1 retrocopy | |
| Homo sapiens | ENSG00000064199 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000003757 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000008480 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000007436 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000004017 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000004426 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000008379 | 1 retrocopy |