RetrogeneDB ID: | retro_cjac_4079 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | X:66038579..66039011(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSCJAG00000010604 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CNBP | ||
| Ensembl ID: | ENSCJAG00000017430 | ||
| Aliases: | None | ||
| Description: | CCHC-type zinc finger, nucleic acid binding protein [Source:HGNC Symbol;Acc:13164] |
| Percent Identity: | 69.86 % |
| Parental protein coverage: | 82.02 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | GRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDCDLQEDEACYNCGRGGHIAKDCKEPKREREQCCYNC |
| GRG.....RG.Q..S..L...CYRCGESGH.AK.C.L.....CYNCGR.GHIAKDC.EPKRER.QCCY.C | |
| Retrocopy | GRGDRGHGRGSQCSSTTLSYTCYRCGESGHQAKNCVL--GNICYNCGRSGHIAKDCNEPKRERDQCCYTC |
| Parental | GKPGHLARDCDHADEQKCYSCGEFGHIQKDCTKVKCYRCGETGHVAINCSKTSEVNCYRCGESGHLAREC |
| G.PGHLA.DCD...EQKCY.CG..GHIQKDC..VKCYRCGETGH.AI.CSK...VNC.RCG.SGHLAREC | |
| Retrocopy | GRPGHLACDCDRRKEQKCYVCGKLGHIQKDCAEVKCYRCGETGHMAISCSKAIQVNCFRCGKSGHLAREC |
| Parental | TIEATA |
| ..EATA | |
| Retrocopy | SSEATA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 44 .86 RPM |
| SRP051959_heart | 0 .02 RPM | 120 .47 RPM |
| SRP051959_kidney | 0 .00 RPM | 94 .22 RPM |
| SRP051959_liver | 0 .00 RPM | 93 .66 RPM |
| SRP051959_lung | 0 .00 RPM | 77 .24 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 73 .88 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 206 .28 RPM |
| SRP051959_spleen | 0 .00 RPM | 81 .70 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000012159 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000017430 | 1 retrocopy |
retro_cjac_4079 ,
|
| Equus caballus | ENSECAG00000009512 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000008408 | 5 retrocopies | |
| Felis catus | ENSFCAG00000028042 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000002502 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000008696 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000013898 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000015070 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000011874 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000017132 | 1 retrocopy |