RetrogeneDB ID: | retro_cjac_2110 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 22:29589905..29590266(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PSMB2 | ||
| Ensembl ID: | ENSCJAG00000001547 | ||
| Aliases: | None | ||
| Description: | proteasome (prosome, macropain) subunit, beta type, 2 [Source:HGNC Symbol;Acc:9539] |
| Percent Identity: | 78.86 % |
| Parental protein coverage: | 52.14 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | PSFARRCCLTGETGKSARLALCRTWSPWPPATMEYLIGIQGPDYVLVASDRVAASNIVQMKDADHDKMFK |
| PSF..RCCLTGET.K.....LC.T.SPWPPAT.EYLIGIQGPDY.LV.SDRVAASNIVQMKD..HDKMFK | |
| Retrocopy | PSFTQRCCLTGETRKPVSVVLCLTCSPWPPATVEYLIGIQGPDYALVTSDRVAASNIVQMKD-NHDKMFK |
| Parental | MSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMR-NGYELSPTAAANFTRRNLA |
| MSEKILLLCVG.AG.T.QFAEY.QK.V.LYKMR.NGYE.SPTAA.NFT..NLA | |
| Retrocopy | MSEKILLLCVGKAGNT-QFAEYFQKKVLLYKMR>NGYESSPTAATNFTHGNLA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .02 RPM | 14 .20 RPM |
| SRP051959_heart | 0 .02 RPM | 10 .26 RPM |
| SRP051959_kidney | 0 .00 RPM | 13 .02 RPM |
| SRP051959_liver | 0 .00 RPM | 18 .48 RPM |
| SRP051959_lung | 0 .02 RPM | 10 .74 RPM |
| SRP051959_lymph_node | 0 .02 RPM | 12 .47 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 18 .80 RPM |
| SRP051959_spleen | 0 .02 RPM | 17 .06 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000000715 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000003543 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000001547 | 1 retrocopy |
retro_cjac_2110 ,
|
| Dasypus novemcinctus | ENSDNOG00000017663 | 1 retrocopy | |
| Equus caballus | ENSECAG00000021615 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000019511 | 1 retrocopy | |
| Felis catus | ENSFCAG00000030845 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000000421 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017902 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000014891 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000012259 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000001871 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000000409 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000016996 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000005230 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000005648 | 2 retrocopies |