RetrogeneDB ID: | retro_btau_1480 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 6:12611769..12612006(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSBTAG00000011299 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | BT.55679 | ||
| Ensembl ID: | ENSBTAG00000002060 | ||
| Aliases: | None | ||
| Description: | 60S ribosomal protein L19 [Source:UniProtKB/Swiss-Prot;Acc:Q3T0W9] |
| Percent Identity: | 86.42 % |
| Parental protein coverage: | 51.27 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | RYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLKADKARKKLLADQAEARRSKTKEARKRREERL |
| RYR.SKKID.HMYHSLYLK..GNVFK.K.ILMEHIHKLKAD.ARKKLLADQAEARR.KTKEARKRREERL | |
| Retrocopy | RYRASKKIDLHMYHSLYLK--GNVFKTKQILMEHIHKLKADQARKKLLADQAEARRAKTKEARKRREERL |
| Parental | QAKKEEIIKTL |
| .A.KEEIIKT. | |
| Retrocopy | RAEKEEIIKTV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 151 .83 RPM |
| ERP005899_muscle | 0 .00 RPM | 753 .46 RPM |
| SRP017611_brain | 0 .00 RPM | 156 .63 RPM |
| SRP017611_kidney | 0 .00 RPM | 272 .53 RPM |
| SRP017611_liver | 0 .00 RPM | 199 .87 RPM |
| SRP030211_testis | 0 .01 RPM | 98 .68 RPM |