RetrogeneDB ID: | retro_vvin_78 | ||
Retrocopy location | Organism: | Grape (Vitis vinifera) | |
| Coordinates: | 14:8027734..8027963(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | VIT_14s0081g00140 | ||
| Aliases: | None | ||
| Description: | None |
Retrocopy-Parental alignment summary:
>retro_vvin_78
ATGAACCATCATATCAAATACTTTAACTGCCTCATCCATTTCAGATCGCAAACAATGTCCATCTATCAATGCAGTGTAGG
TGACTACATCAGGCTCCACGCCACTTTGAAACATCATGTCAACCACATCATGTGCTTGGGCGACCATTCCTTCTTTACAG
AGTGCATCCACCACTGTAGTCAAACTAATTGCATTTGGCATTATCTTGCTATCTACCATTTCATTCAAC
ORF - retro_vvin_78 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 58.44 % |
| Parental protein coverage: | 66.67 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
Retrocopy - Parental Gene Alignment:
| Parental | MNHRIKYFNCLIHFRLQTVSIHQCIVGDYIRLHTSYNHHVDYIMSFRDLSFFTDPL-IRVVKVAVSSSAT |
| MNH.IKYFNCLIHFR.QT.SI.QC.VGDYIRLH....HHV..IM...D.SFFT......VVK........ | |
| Retrocopy | MNHHIKYFNCLIHFRSQTMSIYQCSVGDYIRLHATLKHHVNHIMCLGDHSFFTECI>TTVVKLIAFGIIL |
| Parental | KSHISFS |
| .S.ISF. | |
| Retrocopy | LSTISFN |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
Vitis vinifera was not studied using RNA-Seq expression data.
Vitis vinifera was not studied using ChIP-Seq data.
Vitis vinifera was not studied using EST data.
Vitis vinifera was not studied using FANTOM5 data.
retro_vvin_78 was not experimentally validated.
Retrocopy orthology:
Vitis vinifera does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.Parental genes homology:
Parental genes homology involve 1 parental gene, and 2 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Vitis vinifera | VIT_14s0081g00140 | 2 retrocopies |
retro_vvin_132, retro_vvin_78 ,
|