RetrogeneDB ID: | retro_vpac_221 | ||
Retrocopy location | Organism: | Alpaca (Vicugna pacos) | |
| Coordinates: | GeneScaffold_2975:1334999..1335235(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TUSC2 | ||
| Ensembl ID: | ENSVPAG00000007903 | ||
| Aliases: | None | ||
| Description: | tumor suppressor candidate 2 [Source:HGNC Symbol;Acc:17034] |
| Percent Identity: | 81.25 % |
| Parental protein coverage: | 72.48 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MGASGSKAR-GLWPFASAAGGGGPEAVVAEQALVRRQGRVVPPFVFTRRGXXXXXXDGDLAREFREETVV |
| MGASGSKAR.G.WPF.SAAGGGGPEA.VAEQALVR..GRVVPPFVFTRRG......DGDLA.EF.EETVV | |
| Retrocopy | MGASGSKAR<GVWPFGSAAGGGGPEAAVAEQALVRPRGRVVPPFVFTRRGSMFDDEDGDLAHEFYEETVV |
| Parental | TKNGQQRAKL |
| TKNGQ.RAKL | |
| Retrocopy | TKNGQKRAKL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dipodomys ordii | ENSDORG00000007859 | 2 retrocopies | |
| Felis catus | ENSFCAG00000031595 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000002499 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000008080 | 3 retrocopies | |
| Tarsius syrichta | ENSTSYG00000010483 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000007903 | 1 retrocopy |
retro_vpac_221 ,
|