RetrogeneDB ID: | retro_ttru_1697 | ||
Retrocopy location | Organism: | Dolphin (Tursiops truncatus) | |
| Coordinates: | scaffold_86323:156388..156622(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COMMD6 | ||
| Ensembl ID: | ENSTTRG00000003379 | ||
| Aliases: | None | ||
| Description: | COMM domain containing 6 [Source:HGNC Symbol;Acc:24015] |
| Percent Identity: | 93.59 % |
| Parental protein coverage: | 63.41 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | ALMEGCSEPQLDAKAKVTNQLIDFQWKLGMAVSSDSCRSLKYPYVAVMLKVADHSGQVKNKSFEMTIPQF |
| A.MEGCSEPQL.AKAKVTNQLIDFQWKLGMAVSSDSCRSLKYPYVAVMLKVADHSGQVKNKSFEMTIPQF | |
| Retrocopy | AAMEGCSEPQLEAKAKVTNQLIDFQWKLGMAVSSDSCRSLKYPYVAVMLKVADHSGQVKNKSFEMTIPQF |
| Parental | QNFYRQFK |
| QNFY...K | |
| Retrocopy | QNFYSSRK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dipodomys ordii | ENSDORG00000011048 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000006061 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000010697 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000000970 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000026952 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000038012 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000003379 | 2 retrocopies |
retro_ttru_1697 , retro_ttru_908,
|