RetrogeneDB ID: | retro_tsyr_1307 | ||
Retrocopy location | Organism: | Tarsier (Tarsius syrichta) | |
| Coordinates: | scaffold_3889:40004..40232(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS18 | ||
| Ensembl ID: | ENSTSYG00000012508 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S18 [Source:HGNC Symbol;Acc:10401] |
Retrocopy-Parental alignment summary:
>retro_tsyr_1307
GTGGTGTTGAGGAAAACCAACACTGACCTCACCAAGAGGGCAAGAGGACTCACTGAGGATGAGATTGAACATGCAGTCAC
CATCATTCAGAATCCGCACCCACACAAGGTCCCAGATTGGTCCTTAAACAGACAGAAGGATGTAAAGCATGGAAAATACA
GACAGGTCTTGGTCAATGATCTGATAAACAAGCTCTATGAAGACATGGAGCGACTACCTGATCTCAAA
ORF - retro_tsyr_1307 Open Reading Frame is conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 65.79 % |
| Parental protein coverage: | 59.84 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
Retrocopy - Parental Gene Alignment:
| Parental | VVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLE |
| VVLRK...DLTKRA..LTEDE.E...TI.QNP...K.PDW.LNRQKDVK.GKY.QVL.N.L.NKL.ED.E | |
| Retrocopy | VVLRKTNTDLTKRARGLTEDEIEHAVTIIQNPHPHKVPDWSLNRQKDVKHGKYRQVLVNDLINKLYEDME |
| Parental | RLKKIR |
| RL.... | |
| Retrocopy | RLPDLK |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
Tarsius syrichta was not studied using RNA-Seq expression data.
Tarsius syrichta was not studied using ChIP-Seq data.
Tarsius syrichta was not studied using EST data.
Tarsius syrichta was not studied using FANTOM5 data.
retro_tsyr_1307 was not experimentally validated.
Retrocopy orthology:
Tarsius syrichta does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.Parental genes homology:
Parental genes homology involve 3 parental genes, and 10 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000010356 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000032173 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000012508 | 8 retrocopies |
retro_tsyr_1121, retro_tsyr_1307 , retro_tsyr_1627, retro_tsyr_194, retro_tsyr_1949, retro_tsyr_2042, retro_tsyr_575, retro_tsyr_639,
|