RetrogeneDB ID: | retro_tbel_3243 | ||
Retrocopy location | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | scaffold_134736:102454..102678(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PPP1R1A | ||
| Ensembl ID: | ENSTBEG00000001193 | ||
| Aliases: | None | ||
| Description: | protein phosphatase 1, regulatory (inhibitor) subunit 1A [Source:HGNC Symbol;Acc:9286] |
| Percent Identity: | 69.74 % |
| Parental protein coverage: | 54.89 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | IRRRRPTPATLV-LTSDQSS-PEIDEDRIPNPLLKSTLSMSPRQRKKMTRTTPTMKELQMMVEHHLGQQQ |
| I.R....PATL..LTS..S...EIDED.IPNPLLKSTL.MSP.Q.KKM.R.T.TM.ELQMMVEH.L.QQQ | |
| Retrocopy | ICRGTSIPATLG<LTSE*SAIAEIDED*IPNPLLKSTLPMSPGQQKKMPRITCTMRELQMMVEHQLEQQQ |
| Parental | Q-EEPE |
| Q.EEPE | |
| Retrocopy | QGEEPE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Felis catus | ENSFCAG00000010159 | 1 retrocopy | |
| Homo sapiens | ENSG00000135447 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000008380 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000004608 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000005044 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000001193 | 20 retrocopies |
retro_tbel_1191, retro_tbel_1233, retro_tbel_1251, retro_tbel_1264, retro_tbel_138, retro_tbel_1881, retro_tbel_2036, retro_tbel_2437, retro_tbel_2574, retro_tbel_2720, retro_tbel_3243 , retro_tbel_3316, retro_tbel_3377, retro_tbel_3380, retro_tbel_3414, retro_tbel_3426, retro_tbel_4551, retro_tbel_537, retro_tbel_669, retro_tbel_899,
|