RetrogeneDB ID: | retro_stub_151 | ||
Retrocopy location | Organism: | Potato (Solanum tuberosum) | |
| Coordinates: | 9:646921..647079(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | PGSC0003DMG400011024 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 55.56 % |
| Parental protein coverage: | 72.22 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | VANELIVNGLSN-SASFQRFAVRTSKRMEDLSKMAQQKRQE-IADQVKDVSKNF |
| V..E...NG..N.S..FQRFAVRTS.R..DLSKM..Q...E.IA...KD.SK.F | |
| Retrocopy | VSFEVLLNGIKN*SSGFQRFAVRTSRRIKDLSKMVEQTKKE<IANHMKDASK*F |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Solanum tuberosum | PGSC0003DMG400011024 | 1 retrocopy |
retro_stub_151 ,
|
| Vitis vinifera | VIT_08s0105g00510 | 3 retrocopies |