RetrogeneDB ID: | retro_sscr_873 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 6:73916537..73916845(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSSSCG00000030273 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 66.35 % |
| Parental protein coverage: | 62.5 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | TGSVDIIVT-DMPFGKRMGSKKRNWDLYPACLREMSRVCRPGTGRAVLLTQDKKCFTKALSAMGHVW--- |
| .GSVDI.VT.DMP...RM.SKKRNW.LYPAC..EMS.VC..GTG.AVL..QD...FTKAL..MG.VW... | |
| Retrocopy | SGSVDITVT<DMPYWIRMVSKKRNWYLYPACFWEMSHVCGLGTGQAVLHAQDRRRFTKALPGMGCVWCGW |
| Parental | RKVHTVWVNIGGLHAAVYLLKRTPQTFVHPSEQD |
| .KV..VWVN.GG..A..YLLK..PQTFVHPSEQD | |
| Retrocopy | WKVPSVWVNLGGFLALDYLLKHIPQTFVHPSEQD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 15 .93 RPM |
| SRP014902_testis | 0 .00 RPM | 26 .87 RPM |
| SRP018288_heart | 0 .00 RPM | 12 .31 RPM |
| SRP018288_kidney | 0 .00 RPM | 19 .70 RPM |
| SRP018288_liver | 0 .00 RPM | 13 .59 RPM |
| SRP018288_lung | 0 .00 RPM | 17 .62 RPM |
| SRP018856_adipose | 0 .00 RPM | 8 .15 RPM |
| SRP035408_brain | 0 .00 RPM | 19 .44 RPM |
| SRP035408_liver | 0 .00 RPM | 13 .03 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Myotis lucifugus | ENSMLUG00000008538 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000017307 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000017111 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000030273 | 1 retrocopy |
retro_sscr_873 ,
|
| Tupaia belangeri | ENSTBEG00000003450 | 7 retrocopies |