RetrogeneDB ID: | retro_sscr_626 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 2:73753954..73754290(+) | ||
| Located in intron of: | ENSSSCG00000013527 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSSSCG00000015034 | ||
| Aliases: | SDHD, CII-4, CybS, QPs3 | ||
| Description: | Sus scrofa succinate dehydrogenase complex, subunit D, integral membrane protein (SDHD), nuclear gene encoding mitochondrial protein, mRNA. [Source:RefSeq mRNA;Acc:NM_001097516] |
| Percent Identity: | 77.19 % |
| Parental protein coverage: | 70.44 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | MATLWRLSVLCGPRGGGALVLRTSVVRPAHVSAFLQDRHTPGWCGVQHIHLSPSHQASSKAASLHWTGER |
| MATLWRLS.LCG...GGAL.L.T.VV.PAHVSAFL..R...GWCG.QHIHLSPSHQ..SKAASLHWTG.R | |
| Retrocopy | MATLWRLSTLCGAQKGGALFL*TPVVKPAHVSAFLRSRPSGGWCGMQHIHLSPSHQSDSKAASLHWTGKR |
| Parental | VVSVLLLGLLPAAYLNPCS-AMDYSLAAALTLH-GHWGIGQVVT |
| .VSVLLLGL.PAAYLNPCS.AMDY.LA.ALTLH..HW..GQVVT | |
| Retrocopy | AVSVLLLGLFPAAYLNPCS>AMDYPLATALTLH<CHWDTGQVVT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 47 .92 RPM |
| SRP014902_testis | 0 .00 RPM | 37 .62 RPM |
| SRP018288_heart | 0 .00 RPM | 234 .72 RPM |
| SRP018288_kidney | 0 .00 RPM | 260 .25 RPM |
| SRP018288_liver | 0 .00 RPM | 149 .84 RPM |
| SRP018288_lung | 0 .00 RPM | 34 .42 RPM |
| SRP018856_adipose | 0 .00 RPM | 112 .71 RPM |
| SRP035408_brain | 0 .00 RPM | 58 .88 RPM |
| SRP035408_liver | 0 .00 RPM | 114 .78 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000004066 | 3 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000013091 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000008424 | 1 retrocopy | |
| Felis catus | ENSFCAG00000022580 | 3 retrocopies | |
| Homo sapiens | ENSG00000204370 | 8 retrocopies | |
| Gorilla gorilla | ENSGGOG00000026496 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000002763 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000012228 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000015247 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000022980 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000015034 | 3 retrocopies |
retro_sscr_1060, retro_sscr_626 , retro_sscr_627,
|
| Tursiops truncatus | ENSTTRG00000010520 | 5 retrocopies |