RetrogeneDB ID: | retro_rnor_696 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 10:60569499..60569730(+) | ||
| Located in intron of: | ENSRNOG00000029537 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Cdc42se2 | ||
| Ensembl ID: | ENSRNOG00000042449 | ||
| Aliases: | Cdc42se2, RGD1563924 | ||
| Description: | CDC42 small effector protein 2 [Source:UniProtKB/Swiss-Prot;Acc:A1L1K4] |
Retrocopy-Parental alignment summary:
>retro_rnor_696
ATGAGTACATTCTGGTTGTGTTTGAACTGCTGTATTGCAGAGAAGCTTCAGTCTAAGAGGCAACAATAGGTTGACTGAAG
TATGGTGGAAGAGCTAACCAACTTTGTGCACATAGCTCACATAGGATCTGGAGACCTATTTAGTGGAACAAACTCAGTCA
GCTCCATTCAGAACCAAATGCAGTCCAAGAGAGGTTATGGAAGTGGAATGCCTGCTGATGTGCAGACACAA
ORF - retro_rnor_696 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 74.03 % |
| Parental protein coverage: | 91.67 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
Retrocopy - Parental Gene Alignment:
| Parental | MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGM |
| MS.FWLC.NCCIAE..Q.KR....D.SM..E.TNFVH.AH.GSGDLFSG.NSVSSIQNQMQSK.GYG.GM | |
| Retrocopy | MSTFWLCLNCCIAEKLQSKRQQ*VD*SMVEELTNFVHIAHIGSGDLFSGTNSVSSIQNQMQSKRGYGSGM |
| Parental | PANVQMQ |
| PA.VQ.Q | |
| Retrocopy | PADVQTQ |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 91 .45 RPM |
| SRP017611_kidney | 0 .00 RPM | 38 .31 RPM |
| SRP017611_liver | 0 .00 RPM | 8 .14 RPM |
Rattus norvegicus was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_rnor_696 retrocopy.
Rattus norvegicus was not studied using FANTOM5 data.
retro_rnor_696 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_rnor_696 has 0 orthologous retrocopies within eutheria group .Parental genes homology:
Parental genes homology involve 3 parental genes, and 4 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000008774 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000005142 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000042449 | 2 retrocopies |
retro_rnor_461, retro_rnor_696 ,
|