RetrogeneDB ID: | retro_rnor_552 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 1:273367834..273368039(+) | ||
| Located in intron of: | ENSRNOG00000026048 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Lyrm7 | ||
| Ensembl ID: | ENSRNOG00000045961 | ||
| Aliases: | None | ||
| Description: | LYR motif-containing protein 7 [Source:UniProtKB/Swiss-Prot;Acc:B4F7A1] |
| Percent Identity: | 57.75 % |
| Parental protein coverage: | 66.35 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | NDKRALEAARVKINEEFKKHKNETSPEKIKEMLKIGSDVELLLR-TSVIQ-GIHTDHDTLQLVPRKDLLT |
| NDK..LEAARVK..EEFK.H..ETSPE...E..KI.S.V.L.LR.TSV.Q...HTDH..L....RK.L.. | |
| Retrocopy | NDKTTLEAARVKVVEEFKNH*SETSPENREELMKISSGVKLFLR<TSVKQ<SVHTDHHALTHLSRKELHP |
| Parental | E |
| E | |
| Retrocopy | E |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 12 .94 RPM |
| SRP017611_kidney | 0 .00 RPM | 16 .19 RPM |
| SRP017611_liver | 0 .07 RPM | 3 .97 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017776 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000000736 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000006766 | 6 retrocopies | |
| Echinops telfairi | ENSETEG00000010130 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000000166 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000015568 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000045961 | 1 retrocopy |
retro_rnor_552 ,
|