RetrogeneDB ID: | retro_ptro_368 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 1:165203910..165204336(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PACRGL | ||
| Ensembl ID: | ENSPTRG00000015945 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 62.07 % |
| Parental protein coverage: | 64.71 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | GTQLKNRATGNYDQRTSSSTQIKHRNAVQGSKSSLSTSSPESARKLHPRPSDKLNPKTINPFGEQSRAPS |
| G.........N.DQR.S.ST.IKHR..V..S....S..SP.SARK.....SDKL.PK.IN.FGEQS.APS | |
| Retrocopy | GEVMVGERCSNCDQRKSPST*IKHRTTVHQSTFLFSNTSPQSARKAYAQLSDKLIPKIINLFGEQS*APS |
| Parental | AFAAIYSKGGIPCRLVHGSVKHRLQWEC-PPESLSFDPL-LITLAEGLRETKHPYTFVSKEGFRELLLVK |
| A..AIYSKG..PCRL.H.SVKHRLQW.C.PPE.L...PL.LI.LAE..R..KHPYTFV.KEGFRELLL.K | |
| Retrocopy | ALEAIYSKGAVPCRLAHHSVKHRLQWDC<PPENLALEPL>LIILAEDVRD-KHPYTFVPKEGFRELLLFK |
| Parental | GAPEK |
| ..PEK | |
| Retrocopy | CRPEK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .36 RPM | 3 .72 RPM |
| SRP007412_cerebellum | 0 .14 RPM | 4 .59 RPM |
| SRP007412_heart | 0 .00 RPM | 2 .71 RPM |
| SRP007412_kidney | 0 .00 RPM | 5 .70 RPM |
| SRP007412_liver | 0 .00 RPM | 2 .26 RPM |
| SRP007412_testis | 0 .00 RPM | 47 .53 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_488 |
| Gorilla gorilla | retro_ggor_458 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dipodomys ordii | ENSDORG00000015625 | 1 retrocopy | |
| Homo sapiens | ENSG00000163138 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000012603 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000009937 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000000641 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000002186 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000015945 | 1 retrocopy |
retro_ptro_368 ,
|
| Rattus norvegicus | ENSRNOG00000004140 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000001584 | 1 retrocopy |