RetrogeneDB ID: | retro_ptro_2690 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 8:58116083..58116464(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PDCL2 | ||
| Ensembl ID: | ENSPTRG00000016073 | ||
| Aliases: | None | ||
| Description: | phosducin-like 2 [Source:HGNC Symbol;Acc:29524] |
| Percent Identity: | 50.39 % |
| Parental protein coverage: | 51.87 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | EDVWVITHLYRSSIPMCLLVNQHLSLLARKFPETKFVKAI-VNSCIQHYHDNCLPTIFVYKNGQIEAKFI |
| E..WVI.HLY....P.C.L..QHLS.LARKFP..K..KAI....C...Y.D..LPT.FVY..G.I...FI | |
| Retrocopy | EGLWVILHLYKQGLPLCALIKQHLSGLARKFPDVKLIKAISTTTCTPNYPDRNLPTKFVYLEGDIKPQFI |
| Parental | GIIECGGINLKLEELEWKLAEVGAIQTDLEENPRKDIVDMMVSSI-RNTSIHDDSDS |
| .....GG.NL...ELEWKL...G.I.TDLEENP.K...D...S...R......DSDS | |
| Retrocopy | RPLVFGGMNLTRDELEWKLSQSGEINTDLEENPKKPTEDVLLSLVWRSVLMKRDSDS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .02 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .06 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 45 .53 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3961 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000012692 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000000666 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000007908 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000020680 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000016073 | 7 retrocopies |
retro_ptro_148, retro_ptro_1810, retro_ptro_1865, retro_ptro_2402, retro_ptro_2690 , retro_ptro_2784, retro_ptro_675,
|